RPS27A (AAH01392, 1 a.a. ~ 156 a.a) full-length recombinant protein with GST tag. The sequence is MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE CPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
Conjugate
Unconjugated
Target
Alternative Names
RPS27A; ribosomal protein S27a; UBC; S27A; CEP80; UBA80; HEL112; UBCEP1; UBCEP80; ubiquitin-40S ribosomal protein S27a; ubiquitin C; ubiquitin-CEP80; 40S ribosomal protein S27a; epididymis luminal protein 112; ubiquitin and ribosomal protein S27a; ubiquit
Ubiquitin, a highly conserved protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome, is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein S27a at the C terminus. When expressed in yeast, the protein is post-translationally processed, generating free ubiquitin monomer and ribosomal protein S27a. Ribosomal protein S27a is a component of the 40S subunit of the ribosome and belongs to the S27AE family of ribosomal proteins. It contains C4-type zinc finger domains and is located in the cytoplasm. Pseudogenes derived from this gene are present in the genome. As with ribosomal protein S27a, ribosomal protein L40 is also synthesized as a fusion protein with ubiquitin; similarly, ribosomal protein S30 is synthesized as a fusion protein with the ubiquitin-like protein fubi. Multiple alternatively spliced transcript variants that encode the same proteins have been identified.[provided by RefSeq, Sep 2008]
Pathway
APC/C-mediated degradation of cell cycle proteins; APC/C:Cdc2 mediated degradation of Securin; APC/C:Cdh1 mediated degradation of Cdc2 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1; Activated NOTCH1 Transmits Signal to the Nucleus.
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPAB-DC2756 in a publication? Let us know and earn a reward for your research.
Mathan, G; Fatima, G; et al. Chemoprevention with Aqueous Extract of Butea monosperma Flowers Results in Normalization of Nuclear Morphometry and Inhibition of a Proliferation Marker in Liver Tumors. PHYTOTHERAPY RESEARCH 25:324-328(2011).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-RPS27A polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.