C5orf18 (NP_005660, 113 a.a. ~ 184 a.a) partial recombinant protein with GST tag. The sequence is KCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKK ATVNLLGEEKKS
Conjugate
Unconjugated
Target
Alternative Names
REEP5; receptor accessory protein 5; DP1; TB2; YOP1; D5S346; C5orf18; receptor expression-enhancing protein 5; deleted in polyposis 1; polyposis locus protein 1; receptor expression enhancing protein 5; polyposis coli region hypothetical protein DP1;
REEP5 (receptor accessory protein 5) is a protein-coding gene. Diseases associated with REEP5 include muir-torre syndrome, and lynch syndrome. GO annotations related to this gene include protein binding and molecular_function. An important paralog of this gene is REEP1.
Citations
Publication ()
Have you cited DPAB-DC3257 in a publication? Let us know and earn a reward for your research.
My Review for Anti-REEP5 (aa 113-184) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
