Anti-REEP5 polyclonal antibody (DPAB-DC3257)

Mouse anti-Human REEP5 (aa 113-184) polyclonal antibody for WB, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
C5orf18 (NP_005660, 113 a.a. ~ 184 a.a) partial recombinant protein with GST tag. The sequence is KCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKS
Conjugate
Unconjugated

Target


Alternative Names
REEP5; receptor accessory protein 5; DP1; TB2; YOP1; D5S346
Entrez Gene ID
UniProt ID

Citations


Have you cited DPAB-DC3257 in a publication? Let us know and earn a reward for your research.

References


Yokota, S; Saito, H; et al. Measles virus suppresses interferon-alpha signaling pathway: suppression of Jak1 phosphorylation and association of viral accessory proteins, C and V, with interferon-alpha receptor complex. VIROLOGY 306:135-146(2003).
GONG, K; WEN, DY; et al. PLATELET RECEPTORS FOR THE STREPTOCOCCUS-SANGUIS ADHESIN AND AGGREGATION-ASSOCIATED ANTIGENS ARE DISTINGUISHED BY ANTI-IDIOTYPICAL MONOCLONAL-ANTIBODIES. INFECTION AND IMMUNITY 63:3628-3633(1995).

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-REEP5 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket