Rabbit Anti-Human RBM20 Polyclonal Antibody (DPABH-25939)

Rabbit Anti-Human RBM20 Polyclonal Antibody for IHC, ICC-IF Datasheet

Bring this labeled antibody directly to your bench!

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant Protein, antigen sequence: RRAKEDQALLSVRPLQAHELNDFHGVAPLHLPHICSICDKKVFDLKDWELHVKGKLHAQKCLVFS
Conjugate
unconjugated

Applications


Application Notes
IHC: 1:50 - 1:200
ICC-IF: 1-4 µg/ml
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Data Examples


Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in glomerular cells.
Immunofluorescent staining of human cell line RH-30 shows localization to nucleus & the Golgi apparatus. Antibody staining is shown in green.

Target


Alternative Names
RBM20; RNA binding motif protein 20; RNA-binding protein 20; probable RNA-binding protein 20
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-25939 in a publication? Let us know and earn a reward for your research.

References


Ding, GX; Zhang, AH; et al. SP600125, an inhibitor of c-Jun NH2-terminal kinase, blocks expression of angiotensin II-induced monocyte chemoattractant protein-1 in human mesangial cells. WORLD JOURNAL OF PEDIATRICS 6:169-176(2010).
Jin, KL; Li, WJ; et al. Expression of the RNA-binding protein TIAR is increased in neurons after ischemic cerebral injury. JOURNAL OF NEUROSCIENCE RESEARCH 59:767-774(2000).

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-Human RBM20 Polyclonal Antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket