Anti-QTRTD1 polyclonal antibody (DPABH-18264)

Rabbit anti-Human QTRTD1 (aa 35-84) polyclonal antibody for WB Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Synthetic peptide corresponding to a region within N terminal amino acids 35-84 (YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKF I) of Human QTRTD1 (NP_078914).
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
QTRTD1; queuine tRNA-ribosyltransferase domain containing 1; queuine tRNA-ribosyltransferase subunit QTRTD1; queuine tRNA-ribosyltransferase domain-containing protein 1
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-18264 in a publication? Let us know and earn a reward for your research.

References


Chen, YC; Kelly, VP; et al. Characterization of the human tRNA-guanine transglycosylase: Confirmation of the heterodimeric subunit structure. RNA-A PUBLICATION OF THE RNA SOCIETY 16:958-968(2010).
Zallot, R; Brochier-Armanet, C; et al. Plant, Animal, and Fungal Micronutrient Queuosine Is Salvaged by Members of the DUF2419 Protein Family. ACS CHEMICAL BIOLOGY 9:1812-1825(2014).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-QTRTD1 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket