Anti-PTCD3 polyclonal antibody (DPABH-12909)


Host Species
Antibody Isotype
Species Reactivity
Synthetic peptide within Human PTCD3 aa 97-146. The exact sequence is proprietary.Sequence: LEVIPKIWKDSKEYGHTFRSDLREEILMLMARDKHPPELQVAFADCAADI Database link: Q96EY7-2


Application Notes
WB: 1 μg/ml.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.


Alternative Names
PTCD3; pentatricopeptide repeat domain 3; pentatricopeptide repeat-containing protein 3, mitochondrial; DKFZp666K071; FLJ20758; TRG-15
Entrez Gene ID
UniProt ID


Have you cited DPABH-12909 in a publication? Let us know and earn a reward for your research.

Related Products

Custom Antibody Labeling

We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews

Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket


Hsu, YW; Wang, HJ; et al. Arabidopsis mTERF15 Is Required for Mitochondrial nad2 Intron 3 Splicing and Functional Complex I Activity. PLOS ONE 9:-(2014).

Online Inquiry

Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:
Verification code
Click image to refresh the verification code.

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket