Synthetic peptide within Human PRDM7 aa 6-55 (N terminal). The exact sequence is proprietary.Sequence: FIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGPSGIPQAGLGVW Database link: Q9NQW5-1
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
PRDM7; PR domain containing 7; PFM4; ZNF910; probable histone-lysine N-methyltransferase PRDM7; PR-domain family protein 4; PR domain zinc finger protein 7;
This gene encodes a largely hydrophilic centrosomal protein that is required for anchoring microtubules to subcellular structures. A t(6;8)(q27;p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1. Alterations in this gene may also be associated with Crohns disease, Graves disease, and vitiligo. Alternatively spliced transcript variants that encode different proteins have been identified.
Citations
Publication ()
Have you cited DPABH-13056 in a publication? Let us know and earn a reward for your research.
My Review for Anti-PRDM7 (aa 6-55) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
