Anti-PRDM7 polyclonal antibody (DPABH-13056)

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Synthetic peptide within Human PRDM7 aa 6-55 (N terminal). The exact sequence is proprietary.Sequence: FIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGPSGIPQAGLGVW Database link: Q9NQW5-1
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
PRDM7; PR domain containing 7; PFM4; ZNF910; probable histone-lysine N-methyltransferase PRDM7; PR-domain family protein 4
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-13056 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Hawkins, RD; Bashiardes, S; et al. Gene expression differences in quiescent versus regenerating hair cells of avian sensory epithelia: implications for human hearing and balance disorders. HUMAN MOLECULAR GENETICS 12:1261-1272(2003).
Fumasoni, I; Meani, N; et al. Family expansion and gene rearrangements contributed to the functional specialization of PRDM genes in vertebrates. BMC EVOLUTIONARY BIOLOGY 7:-(2007).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket