Anti-PPP2R2B polyclonal antibody (DPABH-12252)

Rabbit Anti-Human PPP2R2B (aa 164-308) polyclonal antibody for IHC-P, WB

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant fragment corresponding to Human PPP2R2B aa 164-308. (BC031790).Sequence: PRRVFANAHTYHINSISVNSDYETYMSADDLRINLWNFEITNQSFNIVDI KPANMEELTEVITAAEFHPHHCNTFVYSSSKGTIRLCDMRASALCDRHTK FFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIMTRDYLTVKVWD Database link: Q00005
Conjugate
Unconjugated

Applications


Application Notes
IHC-P: 1/100 - 1/500; WB: 1/200 - 1/1000.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
PPP2R2B; protein phosphatase 2, regulatory subunit B, beta; protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), beta isoform; protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform; SCA12, spinocerebellar ataxia 12; serine/
Entrez Gene ID
UniProt ID

Product Background


Pathway
Chagas disease (American trypanosomiasis); Dopaminergic synapse; Glycogen Metabolism; Hepatitis C;

Citations


Have you cited DPABH-12252 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Identification of 46 CAG repeats within PPP2R2B as probably the shortest pathogenic allele for SCA12

PARKINSONISM & RELATED DISORDERS

Authors: Dong, Yi; Wu, Jian-Jun; Wu, Zhi-Ying

Background: Spinocerebellar ataxia type 12 (SCA12) is predominantly characterized by action tremor, followed by slowly progressive cerebellar dysfunction. It is a very rare disorder and only identified in certain countries so far. The current appreciation for phenotypic and genotypic features of SCA12 is still limited. Methods: We investigated CAG copies within PPP2R2B in 29 patients with spinocerebellar ataxia who are excluded from the most common SCA subtypes including SCA1, SCA2, SCA3 and SCA6. The medical data of patients carrying abnormal expanded PPP2R2B allele were reviewed and summarized. Results: We found that 3 patients carried 53, 46 and 54 CAG repeats respectively, while the other 26 cases harbored CAG repeats less than 30. The probably shortest pathogenic allele of 46 repeats was detected in one kindred typically experiencing action tremor. Additionally, compared to the prominent cerebellar ataxia, nystagmus and dysphagia seem to be rare in our SCA12 patients. Conclusions: SCA12 might not be as rare in Chinese as previously assumed. The identification of the shortest pathogenic allele helps to define the minimal limit implicated in the disease onset. Moreover, the disease manifestations distinct from other SCA subtypes could help clinicians to provide timely genetic counseling. (c) 2015 Elsevier Ltd. All rights reserved.

PPP2R2B CAG Repeat Length in the Han Chinese in Taiwan: Association Analyses in Neurological and Psychiatric Disorders and Potential Functional Implications

AMERICAN JOURNAL OF MEDICAL GENETICS PART B-NEUROPSYCHIATRIC GENETICS

Authors: Chen, Chiung-Mei; Hou, Yi-Ting; Liu, Ju-Yun; Wu, Yih-Ru; Lin, Chih-Hsin; Fung, Hon-Chung; Hsu, Wen-Chuin; Hsu, Yuying; Lee, Shen-Hung; Hsieh-Li, Hsiu-Mei; Su, Ming-Tsan; Chen, Shui-Tein; Lane, Hsien-Yuan; Lee-Chen, Guey-Jen

PPP2R2B, a protein widely expressed in neurons throughout the brain, regulates the protein phosphatase 2A (PP2A) activity for the microtubule-associated protein tau and other substrates. Altered PP2A activity has been implicated hi spinocerebellar ataxia 12, Alzheimer's disease (AD), and other tauopathies. Through a case-control study and a reporter assay, we investigated the association of PPP2R2B CAG repeat polymorphism with Taiwanese AD, essential tremor (ET), Parkinson's disease (PD), and schizophrenia and clarified the functional implication of this polymorphism. The distribution of the alleles was not significantly different between patients and controls, with 68.6-76.1% alleles at lengths of 10, 13, and 16 triplets. No expanded alleles were detected in either group. However, the frequency of the individuals carrying the short 5-, 6-, and 7-triplet alleles was notably higher in patients with AD (5/180 [2.8%], Fisher's exact test, P= 0.003; including 2 homozygotes) and ET (4/132 [3.0%], Fisher's exact test, P < 0.001) than in the controls (1/625 [0.2%]). The PPP2R2B transcriptional activity was significantly lower in the luciferase reporter constructs containing the (CAG)(5-7) allele than in those containing the common 10-, 13-, and 16-triplet alleles in both neuroblastoma and embryonic kidney cells. Therefore, our preliminary results suggest that the PPP2R2B gene CAG repeat polymorphism may be functional and may, in part, play a role in conferring susceptibility to AD and ET in Taiwan. (C) 2008 Wiley-Liss, Inc.

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket