Anti-PPP1R9B polyclonal antibody (DPAB-DC3492)

Mouse anti-Human PPP1R9B (aa 708-817) polyclonal antibody for WB,ELISA

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
PPP1R9B (NP_115984, 708 a.a. ~ 817 a.a) partial recombinant protein with GST tag. The sequence is QLEQSVEENKERMEKLEGYWGEAQSLCQAVDEHLRETQAQYQALERKYSKAKRLIKDYQQKEIEFLKKETAQRRVLEESELARKEEMDKLLDKISELEGNLQTLRNSNST
Conjugate
Unconjugated

Target


Alternative Names
PPP1R9B; protein phosphatase 1, regulatory subunit 9B; Spn; SPINO; PPP1R6; PPP1R9
Entrez Gene ID
UniProt ID

Citations


Have you cited DPAB-DC3492 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Ferrer, I; Blanco-Aparicio, C; et al. Spinophilin acts as a tumor suppressor by regulating Rb phosphorylation. CELL CYCLE 10:2751-2762(2011).
Ferrer, I; Peregrino, S; et al. Spinophilin loss contributes to tumorigenesis in vivo. CELL CYCLE 10:1948-1955(2011).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket