Anti-PPP1R11 polyclonal antibody (DPABH-12268)

Rabbit anti-Human PPP1R11 (aa 20-118) polyclonal antibody for WB, IHC-P

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant fragment corresponding to Human PPP1R11 aa 20-118. (BC102010).Sequence: TTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRA FGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQ Database link: O60927
Conjugate
Unconjugated

Applications


Application Notes
WB: 1/200 - 1/1000; IHC-P: 1/100 - 1/500;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
PPP1R11; protein phosphatase 1, regulatory (inhibitor) subunit 11; HCGV; IPP3; HCG-V; TCTE5
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-12268 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Han, YB; Feng, HL; et al. Expression of a novel T-Complex testis expressed 5 (Tctex5) in mouse testis, epididymis, and spermatozoa. MOLECULAR REPRODUCTION AND DEVELOPMENT 74:1132-1140(2007).
Piantoni, P; Bionaz, M; et al. Gene expression ratio stability evaluation in prepubertal bovine mammary tissue from calves fed different milk replacers reveals novel internal controls for quantitative polymerase chain reaction. JOURNAL OF NUTRITION 138:1158-1164(2008).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:
Verification code
Click image to refresh the verification code.

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket