Anti-PLEKHA5 polyclonal antibody (DPABH-14040)

Rabbit Anti-Human PLEKHA5 (aa 1095-1144) polyclonal antibody for WB Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Synthetic peptide within Human PEPP2 aa 1095-1144 (C terminal). The exact sequence is proprietary. Isoform 6.Sequence: ASDQSPLQSPSNLRDNPFRTTQTRRRDDKELDTAIRENDVKPDHETPATE Database link: Q9HAU0-6
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
PLEKHA5; pleckstrin homology domain containing, family A member 5; PEPP2; PEPP-2; pleckstrin homology domain-containing family A member 5; PH domain-containing family A member 5
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-14040 in a publication? Let us know and earn a reward for your research.

References


Brown, MT; Andrade, J; et al. ASAP1, a phospholipid-dependent Arf GTPase-activating protein that associates with and is phosphorylated by Src. MOLECULAR AND CELLULAR BIOLOGY 18:7038-7051(1998).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-PLEKHA5 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket