Synthetic peptide within Human PEPP2 aa 1095-1144 (C terminal). The exact sequence is proprietary. Isoform 6.Sequence: ASDQSPLQSPSNLRDNPFRTTQTRRRDDKELDTAIRENDVKPDHETPATE Database link: Q9HAU0-6
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
PLEKHA5; pleckstrin homology domain containing, family A member 5; PEPP2; PEPP-2; pleckstrin homology domain-containing family A member 5; PH domain-containing family A member 5; phosphoinositol 3-phosphate-binding protein-2;
PLEKHA5 (pleckstrin homology domain containing, family A member 5) is a protein-coding gene. Diseases associated with PLEKHA5 include melanoma. GO annotations related to this gene include protein binding and 1-phosphatidylinositol binding. An important paralog of this gene is PLEKHA6.
Citations
Publication ()
Have you cited DPABH-14040 in a publication? Let us know and earn a reward for your research.
My Review for Anti-PLEKHA5 (aa 1095-1144) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.