Anti-PLCB1 polyclonal antibody (DPAB-DC1067)

Mouse anti-Human PLCB1 (aa 1107-1216) polyclonal antibody for ELISA

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
PLCB1 (NP_056007, 1107 a.a. ~ 1216 a.a) partial recombinant protein with GST tag. The sequence is VQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKPKLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSSEELGGDIPGKEFDTPL
Conjugate
Unconjugated

Target


Alternative Names
PLCB1; phospholipase C, beta 1 (phosphoinositide-specific); PLC-I; EIEE12; PI-PLC; PLC154
Entrez Gene ID
UniProt ID

Product Background


Pathway
AMPK signaling; Activation of Kainate Receptors upon glutamate binding; African trypanosomiasis; Alzheimers Disease

Citations


Have you cited DPAB-DC1067 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


NOMOTO, K; TOMITA, N; et al. EXPRESSION OF PHOSPHOLIPASES GAMMA-1, BETA-1, AND DELTA-1 IN PRIMARY HUMAN COLON CARCINOMAS AND COLON-CARCINOMA CELL-LINES. MOLECULAR CARCINOGENESIS 12:146-152(1995).
ZHOU, CJ; AKHTAR, RA; et al. IDENTIFICATION OF PHOSPHOINOSITIDE-SPECIFIC PHOSPHOLIPASE C-BETA-1 AND GTP-BINDING PROTEIN, G(Q)ALPHA, IN BOVINE IRIS SPHINCTER MEMBRANES - CHARACTERISTICS OF THE PHOSPHOLIPASE AND ITS COUPLING TO CHOLINERGIC MUSCARINIC RECEPTORS. EXPERIMENTAL EYE RESEARCH 59:377-384(1994).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket