Anti-PIP4K2A (aa 304-365) polyclonal antibody

Species Reactivity

Human

Immunogen

PIP5K2A (NP_005019, 304 a.a. ~ 365 a.a) partial recombinant protein with GST tag. The sequence is SDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKEVYFMAIIDILTH YD

Conjugate

Alternative Names

PIP4K2A; phosphatidylinositol-5-phosphate 4-kinase, type II, alpha; PIPK; PI5P4KA; PIP5K2A; PIP5KIIA; PIP5KII-alpha; phosphatidylinositol 5-phosphate 4-kinase type-2 alpha; PIP5KIII; PIP5KIIalpha; PIP4KII-alpha; PI(5)P 4-kinase type II alpha; PtdIns(4)P-5

Entrez Gene ID

UniProt ID

Antigen Description

Phosphatidylinositol-5,4-bisphosphate, the precursor to second messengers of the phosphoinositide signal transduction pathways, is thought to be involved in the regulation of secretion, cell proliferation, differentiation, and motility. The protein encoded by this gene is one of a family of enzymes capable of catalyzing the phosphorylation of phosphatidylinositol-5-phosphate on the fourth hydroxyl of the myo-inositol ring to form phosphatidylinositol-5,4-bisphosphate. The amino acid sequence of this enzyme does not show homology to other kinases, but the recombinant protein does exhibit kinase activity. This gene is a member of the phosphatidylinositol-5-phosphate 4-kinase family.

Pathway

B Cell Receptor Signaling Pathway; D-myo-inositol (1,4,5)-trisphosphate biosynthesis; D-myo-inositol-5-phosphate metabolism; Inositol phosphate metabolism