PIGC (NP_002633, 1 a.a. ~ 54 a.a) partial recombinant protein with GST tag. The sequence is MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFE
Conjugate
Unconjugated
Target
Alternative Names
PIGC; phosphatidylinositol glycan anchor biosynthesis, class C; GPI2; phosphatidylinositol N-acetylglucosaminyltransferase subunit C; PIG-C; phosphatidylinositol-glycan biosynthesis class C protein; phosphatidylinositol-glycan biosynthesis, class C protei
This gene encodes an endoplasmic reticulum associated protein that is involved in glycosylphosphatidylinositol (GPI) lipid anchor biosynthesis. The GPI lipid anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. The encoded protein is one subunit of the GPI N-acetylglucosaminyl (GlcNAc) transferase that transfers GlcNAc to phosphatidylinositol (PI) on the cytoplasmic side of the endoplasmic reticulum. Two alternatively spliced transcripts that encode the same protein have been found for this gene. A pseudogene on chromosome 11 has also been characterized.
Pathway
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis; Metabolism of proteins; Post-translational protein modification.
Citations
Publication ()
Have you cited DPAB-DC2243 in a publication? Let us know and earn a reward for your research.
My Review for Anti-PIGC (aa 1-54) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
