Anti-PCED1B polyclonal antibody (DPABH-12652)

Rabbit anti-Human PCED1B (aa 239-288) polyclonal antibody for WB


Host Species
Antibody Isotype
Species Reactivity
Synthetic peptide within Human FAM113B aa 239-288 (C terminal). The exact sequence is proprietary. (NP_612380)Sequence: CLSQLLLAHVADAWGVELPHRHPVGEWIKKKKPGPRVEGPPQANRNHPAL Database link: Q96HM7


Application Notes
WB: 1 μg/ml;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.


Alternative Names
PCED1B; PC-esterase domain containing 1B; FAM113B; PC-esterase domain-containing protein 1B; family with sequence similarity 113, member B
Entrez Gene ID
UniProt ID


Have you cited DPABH-12652 in a publication? Let us know and earn a reward for your research.

Related Products

Custom Antibody Labeling

We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews

Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

Online Inquiry

Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket