Synthetic peptide within Human FAM113B aa 239-288 (C terminal). The exact sequence is proprietary. (NP_612380)Sequence: CLSQLLLAHVADAWGVELPHRHPVGEWIKKKKPGPRVEGPPQANRNHPAL Database link: Q96HM7
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
PCED1B; PC-esterase domain containing 1B; FAM113B; PC-esterase domain-containing protein 1B; family with sequence similarity 113, member B;
PCED1B (PC-esterase domain containing 1B) is a protein-coding gene. GO annotations related to this gene include hydrolase activity. An important paralog of this gene is PCED1A.
Citations
Publication ()
Have you cited DPABH-12652 in a publication? Let us know and earn a reward for your research.
My Review for Anti-PCED1B (aa 239-288) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
