Anti-PALLD polyclonal antibody (DPAB-DC1033)

Mouse anti-Human PALLD (aa 775-839) polyclonal antibody for WB, ELISA

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
KIAA0992 (NP_057165, 775 a.a. ~ 839 a.a) partial recombinant protein with GST tag. The sequence is MAPFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTT
Conjugate
Unconjugated

Target


Alternative Names
PALLD; palladin, cytoskeletal associated protein; MYN; PNCA1; CGI151; SIH002
Entrez Gene ID
UniProt ID

Citations


Have you cited DPAB-DC1033 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Otey, CA; Dixon, R; et al. Cytoplasmic Ig-Domain Proteins: Cytoskeletal Regulators with a Role in Human Disease. CELL MOTILITY AND THE CYTOSKELETON 66:618-634(2009).
Beck, MR; Otey, CA; et al. Structural Characterization of the Interactions between Palladin and alpha-Actinin. JOURNAL OF MOLECULAR BIOLOGY 413:712-725(2011).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket