Anti-OR5D14 (aa 256-305) polyclonal antibody

Antibody Isotype

IgG

Species Reactivity

Human

Immunogen

Synthetic peptide within Human OR5D14 aa 256-305 (C terminal). The exact sequence is proprietary.Sequence: TILFLYCVPNSKNSRQTVKVASVFYTVVNPMLNPLIYSLRNKDVKDAFWK Database link: Q8NGL3

Conjugate

Application Notes

WB: 1 μg/ml;

Alternative Names

OR5D14; olfactory receptor, family 5, subfamily D, member 14; OR11-141; OR11-150; olfactory receptor 5D14; olfactory receptor OR11-141; olfactory receptor OR11-150;

Entrez Gene ID

UniProt ID

Antigen Description

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. This family member is believed to be a pseudogene.

Pathway

GPCR downstream signaling; Olfactory transduction; Signal Transduction;