Anti-OR5D14 polyclonal antibody (DPABH-13298)

Rabbit anti-Human OR5D14 (aa 256-305) polyclonal antibody for WB Datasheet

Online Inquiry Add to basket


Host Species
Antibody Isotype
Species Reactivity
Synthetic peptide within Human OR5D14 aa 256-305 (C terminal). The exact sequence is proprietary.Sequence: TILFLYCVPNSKNSRQTVKVASVFYTVVNPMLNPLIYSLRNKDVKDAFWK Database link: Q8NGL3


Application Notes
WB: 1 μg/ml;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.


Alternative Names
OR5D14; olfactory receptor, family 5, subfamily D, member 14; OR11-141; OR11-150; olfactory receptor 5D14; olfactory receptor OR11-141
Entrez Gene ID
UniProt ID

Product Background

GPCR downstream signaling; Olfactory transduction; Signal Transduction;


Have you cited DPABH-13298 in a publication? Let us know and earn a reward for your research.

Related Products

Custom Antibody Labeling

We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews

Write a review, share your experiences with others and get rewarded !

Online Inquiry

Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-OR5D14 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket