Anti-NKX3-2 polyclonal antibody (DPABH-18649)


Host Species
Antibody Isotype
Species Reactivity
A synthetic peptide corresponding to a region within the N terminal amino acids 2-51(AVRGANTLTSFSIQAILNKKEERGGLAAPEGRPAPGGTAASVAAA PAVCC) of Human BAPX1, NP_001180.


Application Notes
WB: 1 μg/ml;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.


Alternative Names
NKX3-2; NK3 homeobox 2; SMMD; BAPX1; NKX3B; NKX3.2
Entrez Gene ID
UniProt ID

Product Background

Endochondral Ossification;


Have you cited DPABH-18649 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling

We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews

Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket


Schlange, T; Schnipkoweit, I; et al. Chick CFC controls Lefty1 expression in the embryonic midline and nodal expression in the lateral plate. DEVELOPMENTAL BIOLOGY 234:376-389(2001).

Online Inquiry

Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:
Verification code
Click image to refresh the verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket