Synthetic peptide within Human N42L1 aa 163-212 (C terminal). The exact sequence is proprietary.Sequence: GVSREKIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNNARYW Database link: Q5TBK1
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
N4BP2L1; NEDD4 binding protein 2-like 1; CG018; NEDD4-binding protein 2-like 1; hypothetical gene CG018;
My Review for Anti-N4BP2L1 (aa 163-212) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
