Rabbit Anti-MPO Polyclonal antibody (DPABH-23793)

Rabbit Anti-Human MPO Polyclonal antibody for WB, IP, IHC, ELISA Datasheet

Bring this labeled antibody directly to your bench!

Online Inquiry Add to basket


Host Species
Antibody Isotype
Species Reactivity
Human, Mouse
MPO fusion protein, sequence: CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRV (606-657 aa encoded by BC130476)


Application Notes
WB: 1:500-1:1000
IP: 0.5-4.0 ug for IP and 1:500-1:1000 for WB
IHC: 1:20-1:200
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.


Alternative Names
MPO; myeloperoxidase
Entrez Gene ID
UniProt ID


Have you cited DPABH-23793 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling

We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews

Write a review, share your experiences with others and get rewarded !

Online Inquiry

Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-MPO Polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket