Recombinant protein corresponding to amino acids of recombinant MCCD1. The sequence is SQNPKASMEEQTNSRGNGKMTSPPRGPGTHRTAELARAEELLEQQLELYQALLEGQEGAW EAQALVLKIQKLKEQ
Conjugate
Unconjugated
Applications
Application Notes
IHC: 1:20-1:50; IF: 1-4 μg/mL. & The optimal working dilution should be determined by the end user.
Target
Alternative Names
MCCD1; mitochondrial coiled-coil domain 1; mitochondrial coiled-coil domain protein 1;
MCCD1 (mitochondrial coiled-coil domain 1) is a protein-coding gene. Diseases associated with MCCD1 include chronic venous leg ulcers, and systemic lupus erythematosus.
Citations
Publication ()
Have you cited DPAB-DC1864 in a publication? Let us know and earn a reward for your research.
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
