Recombinant protein corresponding to amino acids of recombinant MCCD1. The sequence is SQNPKASMEEQTNSRGNGKMTSPPRGPGTHRTAELARAEELLEQQLELYQALLEGQEGAW EAQALVLKIQKLKEQ
Conjugate
Unconjugated
Applications
Application Notes
IHC: 1:20-1:50; IF: 1-4 μg/mL. & The optimal working dilution should be determined by the end user.
Target
Alternative Names
MCCD1; mitochondrial coiled-coil domain 1; mitochondrial coiled-coil domain protein 1;
MCCD1 (mitochondrial coiled-coil domain 1) is a protein-coding gene. Diseases associated with MCCD1 include chronic venous leg ulcers, and systemic lupus erythematosus.
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPAB-DC1864 in a publication? Let us know and earn a reward for your research.
Xie, J; Marusich, MF; et al. The mitochondrial inner membrane protein mitofilin exists as a complex with SAM50, metaxins 1 and 2, coiled-coil-helix coiled-coil-helix domain-containing protein 3 and 6 and DnaJC11. FEBS LETTERS 581:3545-3549(2007).
Zhao, Q; Ernst, JT; et al. XTT formazan widely used to detect cell viability inhibits HIV type 1 infection in vitro by targeting gp41. AIDS RESEARCH AND HUMAN RETROVIRUSES 18:989-997(2002).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-MCCD1 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis