Anti-Kell polyclonal antibody (DBGA-0203)

Mouse anti-Human Kell (aa 1-732) polyclonal antibody for WB Datasheet

Online Inquiry Add to basket   

Specifications


Host Species
Mouse
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Full length protein corresponding to Human Blood Group Kell Antigen aa 1-732.
Sequence: MEGGDQSEEEPRERSQAGGMGTLWSQESTPEERLPVEGSR PWAVARRVLTAILILGLLLCFSVLLFYNFQNCGPRPCETS VCLDLRDHYLASGNTSVAPCTDFFSFACGRAKETNNSFQE LATKNKNRLRRILEVQNSWHPGSGEEKAFQFYNSCMDTLA IEAAGTGPLRQVIEELGGWRISGKWTSLNFNRTLRLLMSQ YGHFPFFRAYLGPHPASPHTPVIQIDQPEFDVPLKQDQEQ KIYAQIFREYLTYLNQLGTLLGGDPSKVQEHSSLSISITS RLFQFLRPLEQRRAQGKLFQMVTIDQLKEMAPAIDWLSCL QATFTPMSLSPSQSLVVHDVEYLKNMSQLVEEMLLKQRDF LQSHMILGLVVTLSPALDSQFQEARRKLSQKLRELTEQPP
Conjugate
Unconjugated

Citations


Have you cited DBGA-0203 in a publication? Let us know and earn a reward for your research.

References


Finning, K; Martin, P; et al. Fetal genotyping for the K (Kell) and RhC, c, and E blood groups on cell-free fetal DNA in maternal plasma. TRANSFUSION 47:2126-2133(2007).
Kappler-Gratias, S; Peyrard, T; et al. Blood group genotyping by high-throughput DNA analysis: Application to the French panel of RBC reagents. TRANSFUSION CLINIQUE ET BIOLOGIQUE 17:165-167(2010).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-Kell polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket