Synthetic peptide within Human KRT26 aa 384-433 (C terminal). The exact sequence is proprietary. (NP_853517).Sequence: IDIYCNLLDGEERKSKSTCYKSKGYRPVNSGNQAKDSTEETIVKTVVEEL Database link: Q7Z3Y9
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
KRT26; keratin 26; K26; CK26; KRT25B; K25IRS2; keratin, type I cytoskeletal 26; K25B; CK-26; keratin-26; keratin 25B; keratin-25B; cytokeratin-26; type I inner root sheath specific keratin 25 irs2; type I inner root sheath-specific keratin-K25irs2;
The protein encoded by this gene is a member of the keratin superfamily. This keratin protein is a type I keratin that is specific for the inner root sheath of the hair follicle. This gene exists in a cluster with other keratin genes on chromosome 17q21.
Citations
Publication ()
Have you cited DPABH-13017 in a publication? Let us know and earn a reward for your research.
My Review for Anti-KRT26 (aa 384-433) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
