Anti-KLRC1 (aa 1-70) polyclonal antibody

Species Reactivity

Human

Immunogen

KLRC1 (NP_998823, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag. The sequence is MDNQGVIYSDLNLPPNPKRQQRKPKGNKSSILATEQEITYAELNLQKASQDFQGNDKTYH CKDLPSAPEK

Conjugate

Alternative Names

KLRC1; killer cell lectin-like receptor subfamily C, member 1; NKG2; NKG2A; CD159A; NKG2-A/NKG2-B type II integral membrane protein; NK cell receptor A; C-lectin type II protein; natural killer cell lectin; natural killer group protein 2; NKG2-1/B activat

Entrez Gene ID

UniProt ID

Antigen Description

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed.

Pathway

Adaptive Immune System; Antigen processing and presentation; Graft-versus-host disease; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell