Anti- IVa2 Polyclonal antibody (DPATB-H83514)

Specifications


Host Species
Mouse
Antibody Isotype
IgG
Species Reactivity
Adenovirus
Immunogen
Fusion protein: GRRPAALQHQQDQPQAHPGQRAARSAPLHRDPDYADEDPA PVERHDPGPSGRAPTTAVQRKPPQPAKRGDMLDRDAVEQV TELWDRLELLGQTLKSMPTA, corresponding to amino acids 5/104 of Human adenovirus type6IVa2 GRRPAALQHQQDQPQAHPGQRAARSAPLHRDPDYADEDPA PVERHDPGPSGRAPTTAVQRKPPQPAKRG
Conjugate
Unconjugated

Target


Alternative Names
Maturation protein; Protein IVA2

Product Background


Antigen Description
IVa2 is a member of the superfamily of ATPases associated with a wide variety of cellular activities, including membrane fusion, proteolysis, and DNA replication.

Citations


Have you cited DPATB-H83514 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


TRIBOULEY, C; LUTZ, P; et al. PRODUCT OF THE ADENOVIRUS INTERMEDIATE GENE IVA2 IS A TRANSCRIPTIONAL ACTIVATOR OF THE MAJOR LATE PROMOTER. JOURNAL OF VIROLOGY 68:4450-4457(1994).
IMAOKA, S; FUNAE, Y; et al. HEPATIC AND RENAL CYTOCHROME-P-450S IN SPONTANEOUSLY HYPERTENSIVE RATS. BIOCHIMICA ET BIOPHYSICA ACTA 1074:209-213(1991).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket