Anti-Hyaluronidase PH20 polyclonal antibody (DPATB-H81728)

Mouse anti-Streptococcus pyogenes Hyaluronidase PH20 (aa 33-120) polyclonal antibody for WB Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Antibody Isotype
IgG
Species Reactivity
Streptococcus pyogenes
Immunogen
Fusion protein: ADTLTSNSEPNNTYFQTQTLTTTDSEKKVVQPQQKDYYTE LLDQWNSIIAGNDAYDKTNPDMVTFHNKAEKDAQNIIKSY QGLDHENR, corresponding to amino acids 33/120 of Streptococcus pyogenes Hyaluronidase ADTLTSNSEPNNTYFQTQTLTTTDSEKKVVQPQQKDYYTE LLDQWNSIIAGNDAYDKTNPDMVTFHNKAE
Conjugate
Unconjugated

Target


Alternative Names
Extracellular hyaluronate lyase; HYA1; HYAL PH-20; HYAL PH20; Hyal-PH20; HYAL1

Citations


Have you cited DPATB-H81728 in a publication? Let us know and earn a reward for your research.

References


Huang, ZD; Zhao, CM; et al. Recombinant Human Hyaluronidase PH20 Does Not Stimulate an Acute Inflammatory Response and Inhibits Lipopolysaccharide-Induced Neutrophil Recruitment in the Air Pouch Model of Inflammation. JOURNAL OF IMMUNOLOGY 192:5285-5295(2014).
Hou, ST; Mal, A; et al. Molecular cloning and characterization of rat sperm surface antigen 2B1, a glycoprotein implicated in sperm-zona binding. MOLECULAR REPRODUCTION AND DEVELOPMENT 45:193-203(1996).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-Hyaluronidase PH20 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket