Anti-Hyaluronidase PH20 polyclonal antibody (DPATB-H81728)

Mouse anti-Streptococcus pyogenes Hyaluronidase PH20 (aa 33-120) polyclonal antibody for WB

Specifications


Host Species
Mouse
Antibody Isotype
IgG
Species Reactivity
Streptococcus pyogenes
Immunogen
Fusion protein: ADTLTSNSEPNNTYFQTQTLTTTDSEKKVVQPQQKDYYTE LLDQWNSIIAGNDAYDKTNPDMVTFHNKAEKDAQNIIKSY QGLDHENR, corresponding to amino acids 33/120 of Streptococcus pyogenes Hyaluronidase ADTLTSNSEPNNTYFQTQTLTTTDSEKKVVQPQQKDYYTE LLDQWNSIIAGNDAYDKTNPDMVTFHNKAE
Conjugate
Unconjugated

Target


Alternative Names
Extracellular hyaluronate lyase; HYA1; HYAL PH-20; HYAL PH20; Hyal-PH20; HYAL1

Citations


Have you cited DPATB-H81728 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Jacobetz, MA; Chan, DS; et al. Hyaluronan impairs vascular function and drug delivery in a mouse model of pancreatic cancer. GUT 62:112-U153(2013).
Hou, ST; Mal, A; et al. Molecular cloning and characterization of rat sperm surface antigen 2B1, a glycoprotein implicated in sperm-zona binding. MOLECULAR REPRODUCTION AND DEVELOPMENT 45:193-203(1996).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket