Anti-SLC10A1 polyclonal antibody (CPBT-46247RH)

Rabbit Anti-Human SLC10A1 (aa 107-156) polyclonal antibody for WB, IHC-P

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Synthetic peptide corresponding to a regionwithin internal sequence amino acids 107-156(VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGI YDGDLKDKVPY) of Human SLC10A1
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
SLC10A1; solute carrier family 10 (sodium/bile acid cotransporter family), member 1; sodium/bile acid cotransporter; NTCP; Na(+)/bile acid cotransporter; Cell growth-inhibiting gene 29 protein
Entrez Gene ID
UniProt ID

Product Background


Pathway
Bile acid and bile salt metabolism, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Recycling of bile acids and salts, organism-specific biosystem;

Citations


Have you cited CPBT-46247RH in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Geyer, J; Fernandes, CF; et al. Cloning and molecular characterization of the orphan carrier protein Slc10a4: Expression in cholinergic neurons of the rat central nervous system. NEUROSCIENCE 152:990-1005(2008).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket