Anti-SLC10A1 (aa 107-156) polyclonal antibody

Antibody Isotype

IgG

Species Reactivity

Human

Immunogen

Synthetic peptide corresponding to a regionwithin internal sequence amino acids 107-156(VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGI YDGDLKDKVPY) of Human SLC10A1

Conjugate

Application Notes

WB: 1 μg/ml.

Alternative Names

SLC10A1; solute carrier family 10 (sodium/bile acid cotransporter family), member 1; sodium/bile acid cotransporter; NTCP; Na(+)/bile acid cotransporter; Cell growth-inhibiting gene 29 protein; Na / bile acid cotransporter; Na / taurocholate transport pro

Entrez Gene ID

UniProt ID

Antigen Description

The protein encoded by this gene belongs to the sodium/bile acid cotransporter family, which are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids. Two homologous transporters are involved in the reabsorption of bile acids; the ileal sodium/bile acid cotransporter with an apical cell localization that absorbs bile acids from the intestinal lumen, bile duct and kidney, and the liver-specific sodium/bile acid cotransporter, represented by this protein, that is found in the basolateral membranes of hepatocytes. Bile acids are the catabolic product of cholesterol metabolism, hence this protein is important for cholesterol homeostasis.

Pathway

Bile acid and bile salt metabolism, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Recycling of bile acids and salts, organism-specific biosystem;