Anti-IRF9 polyclonal antibody (CPBT-54164RH)

Rabbit anti-Human IRF9 polyclonal antibody for ICC/IF, WB, IHC-P

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Synthetic peptide of human ISGF3G that is within the following sequence:PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVW KTRLRCALNK.
Conjugate
Unconjugated

Applications


Application Notes
ICC/IF: 1 μg/ml; WB: 1 - 5 μg/ml; IHC-P: 4 - 8 μg/ml.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
IRF9; interferon regulatory factor 9; interferon stimulated transcription factor 3, gamma (48kD) ,interferon stimulated transcription factor 3, gamma 48kDa , ISGF3G; IFN alpha responsive transcription factor subunit; IFN-alpha-responsive transcription fac
Entrez Gene ID
UniProt ID

Product Background


Pathway
Cytokine Signaling in Immune system, organism-specific biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; IFN-gamma pathway, organism-specific biosystem; Immune System, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; Interferon Signaling, organism-specific biosystem; Interferon alpha/beta signaling, orga

Citations


Have you cited CPBT-54164RH in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket