Anti-HTR1B polyclonal antibody (DPAB-DC1632)

Mouse anti-Human HTR1B (aa 1-49) polyclonal antibody for WB, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
HTR1B (NP_000854, 1 a.a. ~ 49 a.a) partial recombinant protein with GST tag. The sequence is MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWK
Conjugate
Unconjugated

Target


Alternative Names
HTR1B; 5-hydroxytryptamine (serotonin) receptor 1B, G protein-coupled; S12; 5-HT1B; HTR1D2; HTR1DB
Entrez Gene ID
UniProt ID

Product Background


Gene summary
HTR1B (5-Hydroxytryptamine Receptor 1B) is a Protein Coding gene. Diseases associated with HTR1B include prinzmetals variant angina and personality disorder. Among its related pathways are Signaling by GPCR and cAMP signaling pathway. GO annotations related to this gene include G-protein coupled receptor activity and G-protein coupled serotonin receptor activity. An important paralog of this gene is HTR1F. The protein encoded by this intronless gene is a G-protein coupled receptor for serotonin (5-hydroxytryptamine). Ligand binding activates second messengers that inhibit the activity of adenylate cyclase and manage the release of serotonin, dopamine, and acetylcholine in the brain. The encoded protein may be involved in several neuropsychiatric disorders and therefore is often a target of antidepressant and other psychotherapeutic drugs.
Antigen Description
The neurotransmitter serotonin (5-hydroxytryptamine; 5-HT) exerts a wide variety of physiologic functions through a multiplicity of receptors and may be involved in human neuropsychiatric disorders such as anxiety, depression, or migraine. These receptors consist of several main groups subdivided into several distinct subtypes on the basis of their pharmacologic characteristics, coupling to intracellular second messengers, and distribution within the nervous system (Zifa and Fillion, 1992 [PubMed 1359584]). The serotonergic receptors belong to the multigene family of receptors coupled to guanine nucleotide-binding proteins. [supplied by OMIM, Oct 2009]G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances, such as lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Regulates the release of 5-hydroxytryptamine, dopamine and acetylcholine in the brain, and thereby affects neural activity, nociceptive processing, pain perception, mood and behavior. Besides, plays a role in vasoconstriction of cerebral arteries. 5-hydroxytryptamine receptor 1B also known as the 5-HT1B receptor is a protein that in humans is encoded by the HTR1B gene. The 5-HT1B receptor is a 5-HT receptor subtype. 0The function about HTR1B antigen include drug binding; serotonin binding; serotonin receptor activity.
Pathway
Amine ligand-binding receptors; G alpha (i) signalling events; GPCR ligand binding; Monoamine GPCRs.

Citations


Have you cited DPAB-DC1632 in a publication? Let us know and earn a reward for your research.

References


Norton, WHJ; Folchert, A; et al. Comparative Analysis of Serotonin Receptor (HTR1A/HTR1B Families) and Transporter (slc6a4a/b) Gene Expression in the Zebrafish Brain. JOURNAL OF COMPARATIVE NEUROLOGY 511:521-542(2008).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-HTR1B polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket