Rabbit Anti-Human HTR1A Polyclonal Antibody (DPABH-27442)

Rabbit Anti-Human HTR1A Polyclonal Antibody for IHC, ICC-IF Datasheet

Bring this labeled antibody directly to your bench!

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant Protein, antigen sequence: VEKTGADTRHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALA
Conjugate
unconjugated

Applications


Application Notes
IHC: 1:20 - 1:50
ICC-IF: 1-4 µg/ml
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Data Examples


Immunohistochemical staining of human ovary shows weak cytoplasmic positivity in ovarian stroma cells.

Target


Alternative Names
HTR1A; 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled; G-21; 5HT1a; PFMCD; 5-HT1A
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-27442 in a publication? Let us know and earn a reward for your research.

References


Tanaka, S; Kuratsune, H; et al. Autoantibodies against muscarinic cholinergic receptor in chronic fatigue syndrome. INTERNATIONAL JOURNAL OF MOLECULAR MEDICINE 12:225-230(2003).
Tanaka, S; Matsunaga, H; et al. Autoantibodies against four kinds of neurotransmitter receptors in psychiatric disorders. JOURNAL OF NEUROIMMUNOLOGY 141:155-164(2003).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-Human HTR1A Polyclonal Antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket