Anti-HIST1H4H (aa 31-103) polyclonal antibody

Species Reactivity

Human

Immunogen

HIST1H4H (NP_003534, 31 a.a. ~ 103 a.a) partial recombinant protein with GST tag. The sequence is TKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYA LKRQGRTLYGFGG

Conjugate

Alternative Names

HIST1H4H; histone cluster 1, H4h; H4/h; H4FH; histone H4; histone 1, H4h; H4 histone family, member H;

Entrez Gene ID

UniProt ID

Antigen Description

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.

Pathway

Alcoholism; Amyloids; Cell Cycle, Mitotic; Cellular responses to stress