Anti-GADL1 PAb (DPABH-20943)

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
antigen sequence: CHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGAAPF LVC, corresponding to amino acids 218-270 of Human GADL1 (Isoform 1).
Conjugate
Unconjugated

Target


Alternative Names
GADL1; glutamate decarboxylase-like 1; ADC; CSADC; HuADC; HuCSADC
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-20943 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Horvath, L; Cervenak, L; et al. Antibodies against different epitopes of heat-shock protein 60 in children with type I diabetes mellitus. IMMUNOLOGY LETTERS 80:155-162(2002).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket