Anti-EXOG polyclonal antibody (DPABH-09970)

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant full length protein corresponding to Human ENDOGL1 aa 1-368.Sequence: MAIKSIASRLRGSRRFLSGFVAGAVVGAAGAGLAALQFFRSQGAEGALTG KQPDGSAEKAVLEQFGFPLTGTEARCYTNHALSYDQAKRVPRWVLEHISK SKIMGDADRKHCKFKPDPNIPPTFSAFNEDYVGSGWSRGHMAPAGNNKFS SKAMAETFYLSNIVPQDFDN
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
EXOG; endo/exonuclease (5-3), endonuclease G-like; ENGL; ENGLA; ENGLB; ENGL-a
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-09970 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Bosch, AN; Weltan, SM; et al. Fuel substrate kinetics of carbohydrate loading differs from that of carbohydrate ingestion during prolonged exercise. METABOLISM-CLINICAL AND EXPERIMENTAL 45:415-423(1996).
Mason, PA; Cox, LS; et al. The role of DNA exonucleases in protecting genome stability and their impact on ageing. AGE 34:1317-1340(2012).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket