Anti-EFNB2 monoclonal antibody (DCABH-6944)

Specifications


Host Species
Mouse
Antibody Isotype
IgG1
Clone
QB4502954
Species Reactivity
Human
Immunogen
Recombinant fragment (His-tag) corresponding to Human Ephrin B2 aa 1-227. Partial extracellular domain with Fc and His tags (NP_004084.1).Sequence: MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVL YPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLN CAKPD
Conjugate
Unconjugated

Applications


Application Notes
IHC-P: 1/100; WB: 5 μg/ml.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
EFNB2; ephrin-B2; EPLG5; eph related receptor tyrosine kinase ligand 5; HTK ligand; Htk L
Entrez Gene ID
UniProt ID

Product Background


Pathway
Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; EPHB forward signaling, organism-specific biosystem; Ephrin B reverse signaling, organism-specific biosystem; EphrinB-EPHB pathway, organism-specific biosystem;

Citations


Have you cited DCABH-6944 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket