Anti-DYNLL1 polyclonal antibody (DPABH-18865)

Rabbit anti-Human DYNLL1 (aa 36-85) polyclonal antibody for WB Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Synthetic peptide corresponding to a region within the internal sequence amino acids 36-85 (KDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAIL L) of Human DLC8 (NP_001032583).
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
DYNLL1; dynein, light chain, LC8-type 1; DNCL1, dynein, cytoplasmic, light polypeptide 1; dynein light chain 1, cytoplasmic; DLC1; DLC8
Entrez Gene ID
UniProt ID

Product Background


Pathway
Activation of BH3-only proteins; Activation of BIM and translocation to mitochondria; Apoptosis; Cell Cycle; Cell Cycle, Mitotic; Centrosome maturation; G2/M Transition

Citations


Have you cited DPABH-18865 in a publication? Let us know and earn a reward for your research.

References


Goggolidou, P; Stevens, JL; et al. ATMIN is a transcriptional regulator of both lung morphogenesis and ciliogenesis. DEVELOPMENT 141:3966-3977(2014).
Camarillo, C; Miranda, RC; et al. Ethanol exposure during neurogenesis induces persistent effects on neural maturation: Evidence from an ex vivo model of fetal cerebral cortical neuroepithelial progenitor maturation. GENE EXPRESSION 14:159-171(2008).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-DYNLL1 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket