Anti-CRISP2 polyclonal antibody (DPAB-DC3106)

Mouse Anti-Human CRISP2 (aa 154-243) polyclonal antibody for WB, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
CRISP2 (NP_003287, 154 a.a. ~ 243 a.a) partial recombinant protein with GST tag. The sequence is YCPNQDSLKYYYVCQYCPAGNNMNRKNTPYQQGTPCAGCPDDCDKGLCTNSCQYQDLLSNCDSLKNTAGCEHELLKEKCKATCLCENKIY
Conjugate
Unconjugated

Target


Alternative Names
CRISP2; cysteine-rich secretory protein 2; CT36; TPX1; TSP1; GAPDL5
Entrez Gene ID
UniProt ID

Product Background


Antigen Description
CRISP2 (cysteine-rich secretory protein 2) is a protein-coding gene. Diseases associated with CRISP2 include epididymitis, and male infertility. An important paralog of this gene is CLEC18B. Cysteine-rich secretory protein 2 is a cysteine-rich secretory protein that in humans is encoded by the CRISP2 gene.

Citations


Have you cited DPAB-DC3106 in a publication? Let us know and earn a reward for your research.

References


Olrichs, NK; Mahalka, AK; et al. Golgi-Associated plant Pathogenesis Related protein 1 (GAPR-1) forms amyloid-like fibrils by interaction with acidic phospholipids and inhibits A beta aggregation. AMYLOID-JOURNAL OF PROTEIN FOLDING DISORDERS 21:88-96(2014).
Busso, D; Goldweic, NM; et al. Evidence for the involvement of testicular protein CRISP2 in mouse sperm-egg fusion. BIOLOGY OF REPRODUCTION 76:701-708(2007).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-CRISP2 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket