Anti-COL27A1 polyclonal antibody (DPABH-13183)

Rabbit anti-Human COL27A1 (aa 551-600) polyclonal antibody for WB

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Synthetic peptide within Human COL27A1 aa 551-600 (internal sequence). The exact sequence is proprietary.Sequence: LPGPKGDKGSRGDWGLQGPRGPPGPRGRPGPPGPPGGPIQLQQDDLGAAF Database link: Q8IZC6-2
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
COL27A1; collagen, type XXVII, alpha 1; collagen alpha-1(XXVII) chain
Entrez Gene ID
UniProt ID

Product Background


Pathway
Amoebiasis; Assembly of collagen fibrils and other multimeric structures; Collagen formation; ECM-receptor interaction

Citations


Have you cited DPABH-13183 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Mayo, JL; Holden, DN; et al. The transcription factor Lc-Maf participates in Col27a1 regulation during chondrocyte maturation. EXPERIMENTAL CELL RESEARCH 315:2293-2300(2009).
Saunders, CJ; van der Merwe, L; et al. Investigation of variants within the COL27A1 and TNC genes and Achilles tendinopathy in two populations. JOURNAL OF ORTHOPAEDIC RESEARCH 31:632-637(2013).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket