EMID2 (NP_597714, 380 a.a. ~ 440 a.a) partial recombinant protein with GST tag. The sequence is ILEHMIGIHDPLASPEGGSGQDAALRANLKMKRGGAQPDGVLAALLGPDPGQKSVDQASS R
Conjugate
Unconjugated
Target
Alternative Names
COL26A1; collagen, type XXVI, alpha 1; EMI6; EMU2; SH2B; EMID2; collagen alpha-1(XXVI) chain; EMI domain containing 2; emilin and multimerin domain-containing protein 2;
This gene encodes a protein containing an emilin domain and two collagen stretches. This gene may be associated with aspirin-intolerant asthma. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Pathway
Collagen biosynthesis and modifying enzymes; Collagen formation; Extracellular matrix organization.
Citations
Publication ()
Have you cited DPAB-DC573 in a publication? Let us know and earn a reward for your research.
My Review for Anti-COL26A1 (aa 380-440) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
