Mouse Anti-Human CHAT Monoclonal Antibody (DPABH-25539)

Mouse Anti-Human CHAT Monoclonal Antibody for IHC Datasheet

Online Inquiry Add to basket   

Specifications


Host Species
Mouse
Antibody Isotype
IgG1
Species Reactivity
Human, Rat, Mouse
Immunogen
Recombinant Protein, antigen sequence: GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTN
Conjugate
unconjugated

Applications


Application Notes
IHC: 1:500-1:1000
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Data Examples


Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in a subset of cells in chorionic villi.

Target


Alternative Names
CHAT; choline O-acetyltransferase; CMS1A; CMS1A2; CHOACTASE; choline acetylase
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-25539 in a publication? Let us know and earn a reward for your research.

References


Layer, PG; Berger, J; et al. Cholinesterases precede ''ON-OFF'' channel dichotomy in the embryonic chick retina before onset of synaptogenesis. CELL AND TISSUE RESEARCH 288:407-416(1997).
HECKERS, S; OHTAKE, T; et al. COMPLETE AND SELECTIVE CHOLINERGIC DENERVATION OF RAT NEOCORTEX AND HIPPOCAMPUS BUT NOT AMYGDALA BY AN IMMUNOTOXIN AGAINST THE P75 NGF RECEPTOR. JOURNAL OF NEUROSCIENCE 14:1271-1289(1994).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Mouse Anti-Human CHAT Monoclonal Antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket