Synthetic peptide within Human CENPL aa 121-170 (internal sequence). The exact sequence is proprietary. (NP_201576)Sequence: FSTLLGMKGTQRDPEAFLVQIVSKSQLPSENREGKVLWTGWFCCVFGDSL Database link: Q8N0S6
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
CENPL; centromere protein L; CENP-L; C1orf155; dJ383J4.3; interphase centromere complex protein 33;
Component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.
Pathway
Cell Cycle; M Phase; Mitotic Metaphase and Anaphase; Resolution of Sister Chromatid Cohesion
Citations
Publication ()
Have you cited DPABH-12504 in a publication? Let us know and earn a reward for your research.
My Review for Anti-CENPL (aa 121-170) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
