Anti-CELSR3 Monoclonal antibody, clone 3G8

Antibody Isotype

IgG1

Clone

3G8

Species Reactivity

Human

Immunogen

CELSR3 (NP_001398, 71 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGSRERETGQGPG SVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHH

Conjugate

Application Notes

WB: 1:500-1000

Alternative Names

CELSR3; cadherin, EGF LAG seven-pass G-type receptor 3 (flamingo homolog, Drosophila); cadherin EGF LAG seven pass G type receptor 3, flamingo (Drosophila) homolog , EGFL1; cadherin EGF LAG seven-pass G-type receptor 3; CDHF11; FMI1; HFMI1; MEGF2; anchor

Entrez Gene ID

UniProt ID

Antigen Description

The protein encoded by this gene is a member of the flamingo subfamily, part of the cadherin superfamily. The flamingo subfamily consists of nonclassic-type cadherins; a subpopulation that does not interact with catenins. The flamingo cadherins are located at the plasma membrane and have nine cadherin domains, seven epidermal growth factor-like repeats and two laminin A G-type repeats in their ectodomain. They also have seven transmembrane domains, a characteristic unique to this subfamily. It is postulated that these proteins are receptors involved in contact-mediated communication, with cadherin domains acting as homophilic binding regions and the EGF-like domains involved in cell adhesion and receptor-ligand interactions. The specific function of this particular member has not been determined.

Pathway

GPCRs, Other, organism-specific biosystem; Multifunctional anion exchangers, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem.