Anti-CELSR3 monoclonal antibody (CAB-2946MH)

Mouse anti-CELSR3 monoclonal antibody for ELISA, WB Datasheet

Online Inquiry Add to basket   

Specifications


Host Species
Mouse
Antibody Isotype
IgG1
Clone
3G8
Species Reactivity
Human
Immunogen
CELSR3 (NP_001398, 71 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGSRERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHH
Conjugate
Unconjugated

Applications


Application Notes
WB: 1:500-1000
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
CELSR3; cadherin, EGF LAG seven-pass G-type receptor 3 (flamingo homolog, Drosophila); cadherin EGF LAG seven pass G type receptor 3, flamingo (Drosophila) homolog , EGFL1; cadherin EGF LAG seven-pass G-type receptor 3; CDHF11; FMI1
Entrez Gene ID
UniProt ID

Product Background


Gene summary
CELSR3 (Cadherin EGF LAG Seven-Pass G-Type Receptor 3) is a Protein Coding gene. Among its related pathways are GPCRs, Other. GO annotations related to this gene include G-protein coupled receptor activity and transmembrane signaling receptor activity. An important paralog of this gene is FAT4. This gene belongs to the flamingo subfamily, which is included in the cadherin superfamily. The flamingo cadherins consist of nonclassic-type cadherins that do not interact with catenins. They are plasma membrane proteins containing seven epidermal growth factor-like repeats, nine cadherin domains and two laminin A G-type repeats in their ectodomain. They also have seven transmembrane domains, a characteristic feature of their subfamily. The encoded protein may be involved in the regulation of contact-dependent neurite growth and may play a role in tumor formation.
Antigen Description
The protein encoded by this gene is a member of the flamingo subfamily, part of the cadherin superfamily. The flamingo subfamily consists of nonclassic-type cadherins; a subpopulation that does not interact with catenins. The flamingo cadherins are located at the plasma membrane and have nine cadherin domains, seven epidermal growth factor-like repeats and two laminin A G-type repeats in their ectodomain. They also have seven transmembrane domains, a characteristic unique to this subfamily. It is postulated that these proteins are receptors involved in contact-mediated communication, with cadherin domains acting as homophilic binding regions and the EGF-like domains involved in cell adhesion and receptor-ligand interactions. The specific function of this particular member has not been determined. Receptor that may have an important role in cell/cell signaling during nervous system formation. Cadherin EGF LAG seven-pass G-type receptor 3 is a protein that in humans is encoded by the CELSR3 gene. 0The function about CELSR3 antigen include G-protein coupled receptor activity; calcium ion binding; protein binding; receptor activity; signal transducer activity.
Pathway
GPCRs, Other, organism-specific biosystem; Multifunctional anion exchangers, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem.

Citations


Have you cited CAB-2946MH in a publication? Let us know and earn a reward for your research.

References


Katoh, M; et al. WNT/PCP signaling pathway and human cancer (review). ONCOLOGY REPORTS 14:1583-1588(2005).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-CELSR3 monoclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket