Synthetic peptide within Mouse CCNB1IP1 aa 4-53 (N terminal). The exact sequence is proprietary.Sequence: CEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNS Database link: NP_001104589 Run BLAST with Run BLAST with
E3 ubiquitin-protein ligase. Modulates cyclin B levels and participates in the regulation of cell cycle progression through the G2 phase. Overexpression causes delayed entry into mitosis.
Citations
Publication ()
Have you cited DPABH-27496 in a publication? Let us know and earn a reward for your research.
My Review for Anti-CCNB1IP1 (aa 4-53) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
