Anti-CCNB1IP1 polyclonal antibody (DPABH-27496)

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Mouse
Immunogen
Synthetic peptide within Mouse CCNB1IP1 aa 4-53 (N terminal). The exact sequence is proprietary.Sequence: CEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNS Database link: NP_001104589 Run BLAST with Run BLAST with
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
CCNB1IP1; cyclin B1 interacting protein 1; E3 ubiquitin-protein ligase CCNB1IP1; mei4; Gm288; Hei10
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-27496 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Strong, ER; Schimenti, JC; et al. Evidence Implicating CCNB1IP1, a RING Domain-Containing Protein Required for Meiotic Crossing Over in Mice, as an E3 SUMO Ligase. GENES 1:440-451(2010).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:
Verification code
Click image to refresh the verification code.

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket