Anti-CCDC87 polyclonal antibody (DPABH-14799)

Rabbit anti-Human CCDC87 (aa 526-638) polyclonal antibody for IHC-P

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant fragment corresponding to Human CCDC87 aa 526-638.Sequence: FLSSAFLRQEKQPQIINPELVGLYSQRANTLQSNTKKMPSLPSLQATKSW EKWSNKASLMNSWKTTLSVDDYFKYLTNHETDFLHVIFQMHEEEVPVEIV APARESLEIQHPP Database link: Q9NVE4
Conjugate
Unconjugated

Applications


Application Notes
IHC-P: 1/200 - 1/500.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
CCDC87; coiled-coil domain containing 87; coiled-coil domain-containing protein 87; FLJ10786
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-14799 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Malnasi-Csizmadia, A; Shimony, E; et al. Dimerization of the head-rod junction of scallop myosin. BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS 252:595-601(1998).
NISSINEN, M; VUOLTEENAHO, R; et al. PRIMARY STRUCTURE OF THE HUMAN LAMININ A-CHAIN - LIMITED EXPRESSION IN HUMAN TISSUES. BIOCHEMICAL JOURNAL 276:369-379(1991).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket