Synthetic peptide within Human C9orf57 aa 18-67 (N terminal). The exact sequence is proprietary. (NP_001122090).Sequence: GLEIRMRRIVFAGVILFRLLGVILFRLLGVILFGRLGDLGTCQTKPGQYW Database link: Q5W0N0
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
C9ORF57; chromosome 9 open reading frame 57; uncharacterized protein C9orf57;
C9orf57 (chromosome 9 open reading frame 57) is a protein-coding gene.
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-12407 in a publication? Let us know and earn a reward for your research.
Peng, JP; Yang, JA; et al. An Integrated Approach for Finding Overlooked Genes in Shigella. PLOS ONE 6:-(2011).
Jin, HJ; Shao, JZ; et al. Identification and characterization of suppressor of cytokine signaling 3 (SOCS-3) homologues in teleost fish. MOLECULAR IMMUNOLOGY 44:1042-1051(2007).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-C9ORF57 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis