Synthetic peptide within Human C4orf3 aa 122-171 (C terminal). The exact sequence is proprietary.Sequence: RFLGLLRSCRSEMEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANG Database link: Q8WVX3-2
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
C4ORF3; chromosome 4 open reading frame 3; uncharacterized protein C4orf3; HCV F-transactivated protein 1; hepatitis C virus F protein-transactivated protein 1;
This gene encodes a protein that binds to all members of the R7 subfamily of regulators of G protein signaling and regulates their translocation between the nucleus and the plasma membrane. The encoded protein could be regulated by reversible palmitoylation, which anchors it to the plasma membrane. Depalmitoylation localizes the protein to the nucleus. Polymorphisms in this gene may be associated with risk of aspirin-exacerbated respiratory disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-13141 in a publication? Let us know and earn a reward for your research.
Height, SE; Swansbury, GJ; et al. Analysis of clonal rearrangements of the Ig heavy chain locus in acute leukemia. BLOOD 87:5242-5250(1996).
KoikeTakeshita, A; Koyama, T; et al. Identification of a novel gene cluster participating in menaquinone (vitamin K-2) biosynthesis - Cloning and sequence determination of the 2-heptaprenyl-1,4-naphthoquinone methyltransferase gene of Bacillus stearothermophilus. JOURNAL OF BIOLOGICAL CHEMISTRY 272:12380-12383(1997).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-C4ORF3 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis