Anti-C4ORF29 polyclonal antibody (DPABH-11710)

Rabbit anti-Human C4ORF29 (aa 122-171) polyclonal antibody for WB


Host Species
Antibody Isotype
Species Reactivity
Synthetic peptide within Human C4orf29 aa 122-171 (N terminal). The exact sequence is proprietary. NP_001034806Sequence: WRRRTLMARPMIKEARMASLLLENPYYGCRKPKDQVRSSLKNVSDLFVMG Database link: Q0P651


Application Notes
WB: 1 μg/ml;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.


Alternative Names
C4ORF29; chromosome 4 open reading frame 29; uncharacterized protein C4orf29
Entrez Gene ID
UniProt ID


Have you cited DPABH-11710 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling

We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews

Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket


Gary, L; Gilden, DH; et al. Epigenetic regulation of varicella-zoster virus open reading frames 62 and 63 in latently infected human trigeminal ganglia. JOURNAL OF VIROLOGY 80:4921-4926(2006).
Luo, H; Chaudhuri, A; et al. Cloning, characterization, and mapping of a murine promiscuous chemokine receptor gene: Homolog of the human duffy gene. GENOME RESEARCH 7:932-941(1997).

Online Inquiry

Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket