Recombinant fragment corresponding to Human C3orf56 aa 1-75 (N terminal).Sequence: MGTGASEKQAEQKVRRAFEASEEAHGTLAASTPWVAMGSAYGSCTCLGAQ PVTDLALWPVIYSCMGFSPQAYPAF Database link: Q8N813
Conjugate
Unconjugated
Applications
Application Notes
IHC-P: 1/20 - 1/50;
Target
Alternative Names
C3ORF56; chromosome 3 open reading frame 56; putative uncharacterized protein C3orf56;
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-14972 in a publication? Let us know and earn a reward for your research.
Musante, L; Bartsch, O; et al. cDNA cloning and characterization of the human THRAP2 gene which maps to chromosome 12q24, and its mouse ortholog Thrap2. GENE 332:119-127(2004).
Sirena, D; Ruzsics, Z; et al. The nucleotide sequence and a first generation gene transfer vector of species B human adenovirus serotype 3. VIROLOGY 343:283-298(2005).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-C3ORF56 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis