Synthetic peptide within Human C11orf91 aa 141-190 (C terminal). The exact sequence is proprietary. (NP_001160164).Sequence: LCELEIRIKELELLTITGDGFDSQSYTFLKALKDEKLQGLKTKQPGKKSA Database link: Q3C1V1
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
C11ORF91; chromosome 11 open reading frame 91; uncharacterized protein C11orf91;
My Review for Anti-C11ORF91 (aa 141-190) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
