Recombinant fragment corresponding to Human ATP8A1 aa 1-69 (N terminal).Sequence: MPTMRRTVSEIRSRAEGYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFC NNHVSTAKYNIITFLPRFL Database link: Q9Y2Q0
Conjugate
Unconjugated
Applications
Application Notes
IHC-P: 1/50 - 1/200;
Target
Alternative Names
ATP8A1; ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1; ATPIA; ATPP2; ATPASEII; probable phospholipid-transporting ATPase IA; ATPase II; chromaffin granule ATPase II; aminophospholipid translocase; ATPase class I type 8A member 1
May play a role in the transport of aminophospholipids from the outer to the inner leaflet of various membranes and the maintenance of asymmetric distribution of phospholipids, mainly in secretory vesicles.
Pathway
Ion channel transport; Peptide GPCRs;
Citations
Publication ()
Have you cited DPABH-14743 in a publication? Let us know and earn a reward for your research.
My Review for Anti-ATP8A1 (aa 1-69) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
