Anti-ATP8A1 polyclonal antibody (DPABH-14743)

Rabbit anti-Human ATP8A1 (aa 1-69) polyclonal antibody for IHC-P

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant fragment corresponding to Human ATP8A1 aa 1-69 (N terminal).Sequence: MPTMRRTVSEIRSRAEGYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFC NNHVSTAKYNIITFLPRFL Database link: Q9Y2Q0
Conjugate
Unconjugated

Applications


Application Notes
IHC-P: 1/50 - 1/200;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
ATP8A1; ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1; ATPIA; ATPP2; ATPASEII; probable phospholipid-transporting ATPase IA
Entrez Gene ID
UniProt ID

Product Background


Pathway
Ion channel transport; Peptide GPCRs;

Citations


Have you cited DPABH-14743 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Levano, KS; Sobocki, T; et al. Mus musculus ATP8A1 and atpase 1B and plasma membrane phosphatidylserine translocation in neuronal cells. JOURNAL OF NEUROCHEMISTRY 104:35-35(2008).
Paterson, JK; Renkema, K; et al. Lipid specific activation of the murine P-4-ATPase Atp8a1 (ATPase II). BIOCHEMISTRY 45:5367-5376(2006).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket