Rabbit Anti-ATP8A1 Polyclonal antibody (DPABH-24510)

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human, Mouse, Rat
Immunogen
ATP8A1 fusion protein, sequence: QNSQFGDEKTFSDSSLLENLQNNHPTAPIICEFLTMMAVCHTAVPEREGDKIIYQAASPDEGALVRAAKQLNFVFTGRTPDSVIIDSLGQEERYELLN (430-527 aa encoded by BC109317)
Conjugate
Unconjugated

Applications


Application Notes
WB: 1:500-1:2000
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
ATP8A1; ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1; ATPIA; ATPP2; ATPASEII; phospholipid-transporting ATPase IA
Entrez Gene ID
UniProt ID

Product Background


Gene summary
ATP8A1 (ATPase Phospholipid Transporting 8A1) is a Protein Coding gene. Diseases associated with ATP8A1 include cerebellar ataxia, mental retardation and dysequlibrium syndrome and intrahepatic cholestasis. Among its related pathways are Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds and Peptide ligand-binding receptors. GO annotations related to this gene include nucleotide binding and cation-transporting ATPase activity. An important paralog of this gene is ATP10A. The P-type adenosinetriphosphatases (P-type ATPases) are a family of proteins which use the free energy of ATP hydrolysis to drive uphill transport of ions across membranes. Several subfamilies of P-type ATPases have been identified. One subfamily catalyzes transport of heavy metal ions. Another subfamily transports non-heavy metal ions (NMHI). The protein encoded by this gene is a member of the third subfamily of P-type ATPases and acts to transport amphipaths, such as phosphatidylserine. Two transcript variants encoding different isoforms have been found for this gene.
Antigen Description
May play a role in the transport of aminophospholipids from the outer to the inner leaflet of various membranes and the maintenance of asymmetric distribution of phospholipids, mainly in secretory vesicles. Catalytic component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes and ensures the maintenance of asymmetric distribution of phospholipids. Phospholipid translocation seems also to be implicated in vesicle formation and in uptake of lipid signaling molecules. In vitro, its ATPase activity is selectively and stereospecifically stimulated by phosphatidylserine (PS). The flippase complex ATP8A1:TMEM30A seems to play a role in regulation of cell migration probably involving flippase-mediated translocation of phosphatidylethanolamine (PE) at the plasma membrane. Acts as aminophospholipid translocase at the plasma membrane in neuronal cells. The function about ATP8A1 antigen include ATP binding; cation-transporting ATPase activity; magnesium ion binding; phospholipid-translocating ATPase activity.

Citations


Have you cited DPABH-24510 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Kerr, DJ; Guariglia, SR; et al. The role of Atp8a1 in neurotransmission, brain development, and autistic behavior. JOURNAL OF NEUROCHEMISTRY 125:262-262(2013).
Soupene, E; Kuypers, FA; et al. Identification of an erythroid ATP-dependent aminophospholipid transporter. BRITISH JOURNAL OF HAEMATOLOGY 133:436-438(2006).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket