Anti-ATP6V0E2 polyclonal antibody (DPABH-12958)

Rabbit anti-Human ATP6V0E2 (aa 24-73) polyclonal antibody for WB

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Synthetic peptide within Human ATP6V0E2 aa 24-73 (N terminal). The exact sequence is proprietary.Sequence: GPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETI Database link: Q8NHE4-3
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
ATP6V0E2; ATPase, H+ transporting V0 subunit e2; C7orf32; ATP6V0E2L; V-type proton ATPase subunit e 2; H+-ATPase e2 subunit
Entrez Gene ID
UniProt ID

Product Background


Gene summary
ATP6V0E2 (ATPase H+ Transporting V0 Subunit E2) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and Metabolism. GO annotations related to this gene include hydrogen ion transmembrane transporter activity and ATPase coupled ion transmembrane transporter activity. An important paralog of this gene is ATP6V0E1. Multisubunit vacuolar-type proton pumps, or H(+)-ATPases, acidify various intracellular compartments, such as vacuoles, clathrin-coated and synaptic vesicles, endosomes, lysosomes, and chromaffin granules. H(+)-ATPases are also found in plasma membranes of specialized cells, where they play roles in urinary acidification, bone resorption, and sperm maturation. Multiple subunits form H(+)-ATPases, with proteins of the V1 class hydrolyzing ATP for energy to transport H+, and proteins of the V0 class forming an integral membrane domain through which H+ is transported. ATP6V0E2 encodes an isoform of the H(+)-ATPase V0 e subunit, an essential proton pump component (Blake-Palmer et al. , 2007 [PubMed 17350184]).
Antigen Description
Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Belongs to the V-ATPase e1/e2 subunit family. The function about ATP6V0E2 antigen include ATPase activity, coupled to transmembrane movement of ions; hydrogen ion transmembrane transporter activity.
Pathway
Collecting duct acid secretion; Disease; Epithelial cell signaling in Helicobacter pylori infection; Iron uptake and transport.

Citations


Have you cited DPABH-12958 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Blake-Palmer, KG; Su, Y; et al. Molecular cloning and characterization of a novel form of the human vacuolar H+-ATPase e-subunit: An essential proton pump component. GENE 393:94-100(2007).
Fuller, JM; Bogdani, M; et al. Genetic dissection reveals diabetes loci proximal to the gimap5 lymphopenia gene. PHYSIOLOGICAL GENOMICS 38:89-97(2009).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket